PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pahal.A01041.3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family CPP
Protein Properties Length: 461aa    MW: 50358.9 Da    PI: 7.2301
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pahal.A01041.3genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR42.21.6e-132158139
             TCR  1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNk 39
                    k+kk+CnC++skClk+YCeCf+++++C+  C+C++C N 
  Pahal.A01041.3 21 KKKKHCNCRNSKCLKMYCECFQEQQFCDG-CNCSNCGNI 58
                    589**************************.******996 PP

2TCR49.96.5e-16106145140
             TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                     k++kgC+Ckks ClkkYCeC++a++ Cs++C+C dCkN e
  Pahal.A01041.3 106 KHNKGCHCKKSGCLKKYCECYQANVLCSKNCRCMDCKNFE 145
                     589***********************************65 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011149.7E-122161IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163435.09222146IPR005172CRC domain
PfamPF036384.1E-102357IPR005172CRC domain
SMARTSM011142.0E-18106147IPR033467Tesmin/TSO1-like CXC domain
PfamPF036383.7E-12109144IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 461 aa     Download sequence    Send to blast
MEQGKNQQHP PSTEAKSVTP KKKKHCNCRN SKCLKMYCEC FQEQQFCDGC NCSNCGNIVG  60
NEKARQEAIN AIVQRNPLAF QPKIENGPST HNVRKDNSGA VPLVPKHNKG CHCKKSGCLK  120
KYCECYQANV LCSKNCRCMD CKNFEGSEER KALIQGDYAS DGNQIQQAAS VALNGTIGSS  180
GYNCSPVRRK RSHEDTLGPR INSEGSMPET QFLQGNHADV SLLAPSSTGF DGHNAANSQS  240
KSYNPIYRSP LANTIHLTEV NDLVTHMVTA CRMAAATIAD NKVNGTTVEN QFHVNGGLSN  300
GNCKQQELKE ASQMDILRRG CSDQPNINEI DSHWSDTAKD SRPASPTTQA LMCDEQETTF  360
GNDYRCSFPS VSCDQDISEI NAAQENLVLT GLREYLRVII TRGKIKEHKS SSEAAMEPDG  420
QQHHGATPIA PREVGENAPS NCAETPRTDQ QPTQNAGSER *
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004952204.10.0PREDICTED: protein tesmin/TSO1-like CXC 5
TrEMBLK3YRR50.0K3YRR5_SETIT; Uncharacterized protein
STRINGSi016959m0.0(Setaria italica)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G29000.11e-94Tesmin/TSO1-like CXC domain-containing protein